PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010935813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 668aa    MW: 73973.9 Da    PI: 4.1689
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010935813.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52251531129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtd+elv++yLk+kv+gk+l++ ++i+e+d+yk+ePwdLp  +++ +++ ewyfFs+ d+ky++ +r nr+t++gyWk+tgkd+++ 
  XP_010935813.1  25 LAPGFRFHPTDDELVSYYLKRKVSGKSLRI-DAIAEIDLYKCEPWDLPplSRIVSRDLEWYFFSPLDRKYSNRSRMNRSTAQGYWKTTGKDRPIR 118
                     579***************************.99**************96558888899************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     + ++++vg+kktLv++ grap+ge+t+Wvmheyrle
  XP_010935813.1 119 H-NHRVVGMKKTLVYHAGRAPRGERTNWVMHEYRLE 153
                     *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6020179IPR003441NAC domain
PROSITE profilePS5100557.53225179IPR003441NAC domain
PfamPF023655.7E-2827152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
MNGGASSSNP RRPVAPATPA AATQLAPGFR FHPTDDELVS YYLKRKVSGK SLRIDAIAEI  60
DLYKCEPWDL PPLSRIVSRD LEWYFFSPLD RKYSNRSRMN RSTAQGYWKT TGKDRPIRHN  120
HRVVGMKKTL VYHAGRAPRG ERTNWVMHEY RLEDQELAGT VTCTGIPQDA YVVCRIFKKS  180
GQGPQNGAQY GAPFNEEEWE ETDGGMIMLR DDGDDDFFDA GEQEQEYLQM NDFLQDSGSH  240
QEDPSVLLEE ILNDPSFGND MVEHTDERGL QNGPALGNDM GQNIGMADSS YTAGQNEGYV  300
ELNDLADTVN AEDPPSEDSV GCSSWTCNDW KPVDGVDDII NFQEILDVDE FFDTVNEDIN  360
QPELFQMSPP LSDNYDMQPI DIRNFLAGDC PSGQLAEGNT MFYDADSNDL AFAQDNFAEL  420
NHLLDLPISD PSRFDMVDNL MAYFDAMDDN LHVDTAGFLE NSGCMNSSIL DQFNLTPEFD  480
GINAQPNEVI PWASEANVAS GPSSSLRLPD ADNQLKTEND VNIKLDVKRS ESNGKTITKR  540
LVNMLGSISA PPAIAAEYPV RSEKPVGQIS ETHSASSIHF TAGMIQIRGL TVTGSTEHWS  600
LQKNGDVDFL LSYGMDGDEA RKSIGFEPIS KIQGGLASVV LRGGFYLFFL SALILTVSYG  660
VGLCICSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-512118211171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010935813.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
TrEMBLM0S4Z21e-180M0S4Z2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P04010_0011e-180(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.12e-85NAC domain containing protein 2